PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN27448.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 314aa    MW: 36224.3 Da    PI: 10.2576
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN27448.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.82.1e-17175221148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT e d  lv++v+q+G + W+ Ia+ ++ gR +kqc++rw+++l
       KHN27448.1 175 KGQWTLEQDNALVELVNQFGLKKWSQIAKLLP-GRIGKQCRERWHNHL 221
                      799*****************************.*************97 PP

2Myb_DNA-binding55.41.4e-17227271147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +++WT eEd +l++a+k+lG++ W+ Ia++++ gR ++ +k++w++ 
       KHN27448.1 227 KDSWTLEEDMILIKAHKKLGNK-WSEIAKRLP-GRPENTIKNHWNTT 271
                      679*******************.*********.************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.183170225IPR017930Myb domain
SuperFamilySSF466896.57E-31172268IPR009057Homeodomain-like
SMARTSM007175.0E-15174223IPR001005SANT/Myb domain
PfamPF002491.9E-15175221IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-26176229IPR009057Homeodomain-like
CDDcd001673.11E-14178221No hitNo description
PROSITE profilePS5129420.19226276IPR017930Myb domain
SMARTSM007171.8E-16226274IPR001005SANT/Myb domain
PfamPF002497.8E-16227271IPR001005SANT/Myb domain
CDDcd001677.98E-13229272No hitNo description
Gene3DG3DSA:1.10.10.602.4E-21230274IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MEFDSSFQGP QYLSSPFPPT TQTMFPSQSS ILIPPSPQPI MFHPNNTTFH HFQDFITNVP  60
TFVMEGPSSN ITTPLYRGSF LGGFVNIHHH HPNKMDALHG HHHKGKIIWD FSQQLMVHSS  120
EASSSKSSSP LSLSNEYGLV MDDYHWHTNQ RSVQQKMKVV KVNMDTNIAN DNIIKGQWTL  180
EQDNALVELV NQFGLKKWSQ IAKLLPGRIG KQCRERWHNH LMPNIKKDSW TLEEDMILIK  240
AHKKLGNKWS EIAKRLPGRP ENTIKNHWNT TKRRQNCKRH KHTIYEGSLL HGYIKKVSAA  300
EDATKEPKKN KMQL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-431732752104MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-4316827551158MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-4316827551158MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-431732752104C-Myb DNA-Binding Domain
1msf_C1e-431732752104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006579767.10.0PREDICTED: uncharacterized protein LOC102668949
TrEMBLA0A0B2R6500.0A0A0B2R650_GLYSO; Transcription factor MYB98
STRINGGLYMA05G08761.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF143361018
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.16e-55myb domain protein 98
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]